🇺🇸 USA Manufactured · 99.9% Purity · COA on Every Order
← Back to Products

Metabolic

Cagrilintide

Long-Acting Amylin Analog

Cagrilintide lipidated amylin analog diagram
C20 diacid–γ-Glu–KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP. Disulfide Cys2–Cys7.

Scientific Overview

Cagrilintide is a lipidated analog of amylin, a pancreatic peptide involved in satiety signaling. Published work describes it as a long-acting amylin analog for receptor and metabolic research.

Mechanism focus: Amylin signals through calcitonin-receptor complexes with receptor-activity-modifying proteins. Research on cagrilintide focuses on that pharmacology and on how a prolonged amylin-receptor agonist behaves in experimental models.

Research Use Cases

Use-Case Study Notations

Selected Studies (English, PubMed)

Three peer-reviewed sources indexed on PubMed. Links open the PubMed record for verification.

  1. Development of Cagrilintide, a Long-Acting Amylin Analogue — PubMed 34288673
  2. Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity — PubMed 36883831
  3. Efficacy and Safety of Cagrilintide Alone and in Combination with Semaglutide (Cagrisema) as Anti-Obesity Medications: A Systematic Review and Meta-Analysis — PubMed 39676787

Related compounds

Semaglutide · AOD-9604

View full catalog → · Research library →

Research Use Only. This page is educational and intended for laboratory research context. Products are not for human consumption and are not intended to diagnose, treat, cure, or prevent any disease.

Shop Cagrilintide Wholesale pricing All Products